VIP

270.00 AED — In stock

Vasoactive Intestinal Peptide (VIP) is a next‑generation peptide research formula designed to support nervous system function, balanced immunity, and respiratory health through multi‑system regulatory pathways. By influencing neuroimmune signaling, smooth muscle relaxation, and anti‑inflammatory mechanisms, VIP is studied for its role in cognitive support, immune modulation, and respiratory homeostasis. This formulation is ideal for research models focused on neuroprotection, immune regulation, inflammation balance, pulmonary function, and systemic wellness in human‑relevant studies. Key Features 🧪 cGMP manufactured in an FDA‑registered facility✅ ≥98% purity confirmed by HPLC analysis📄 Batch‑specific Certificates of Analysis (COAs) included💉 Sterile, lyophilized vials for research use only Human‑Relevant Research Applications 🧠 Neuroimmune & Immune RegulationVIP functions as a neuropeptide and immune regulator by modulating cytokine signaling, downregulating pro‑inflammatory mediators, and promoting tolerogenic responses — relevant for studies on inflammation control and immune homeostasis.🔗 https://pubmed.ncbi.nlm.nih.gov/22139413/ 🫁 Respiratory & Bronchodilatory FunctionVIP has potent bronchodilatory and vasodilatory effects and is being explored for its role in respiratory therapeutics, including modulation of airway smooth muscle and pulmonary inflammation.🔗 https://pubmed.ncbi.nlm.nih.gov/23935337/ ⚖️ Smooth Muscle Relaxation & Vascular EffectsVIP’s homeostatic effects on smooth muscle include inhibition of NF‑κB signaling during inflammatory insults and reversal of inflammatory dysfunction in smooth muscle tissues, supporting research into vascular and respiratory regulation.🔗 https://pubmed.ncbi.nlm.nih.gov/19661154/ 🛡️ Anti‑Inflammatory & Autoimmunity ResearchVIP is a potent anti‑inflammatory factor that controls innate and adaptive immune responses, making it relevant for studies on immune dysregulation, autoimmunity, and chronic inflammation.🔗 https://pubmed.ncbi.nlm.nih.gov/11862320/ Mechanism Summary Modulates neuroimmune signaling and cytokine expression Inhibits pro‑inflammatory pathways while promoting immune tolerance Promotes bronchodilation and smooth muscle relaxation Supports human‑relevant studies in respiratory, immune, and neuroprotective research Reconstitution & Handling Guidance 1️⃣ Use sterile bacteriostatic water (0.9% benzyl alcohol)2️⃣ Add 1–3 ml of bacteriostatic water to reconstitute the peptide (adjust as needed for your experimental concentration)3️⃣ Gently swirl until fully dissolved (do not vortex)4️⃣ Store reconstituted peptide at 4 °C–10 °C for 2–3 months5️⃣ Unreconstituted peptide can be stored at 4 °C–10 °C until the expiration date

More All Products

What is VIP?

VIP (vasoactive intestinal peptide) is a natural 28-amino-acid peptide hormone. It was first isolated from pig intestine in 1970 by Sami Said and Viktor Mutt. It is made by nerve cells in the gut, brain, lungs and other tissues, and belongs to the same family as secretin and glucagon.

VIP acts on two main receptors, VPAC1 and VPAC2. Through these it relaxes smooth muscle in blood vessels and airways, and influences gut secretion. Research suggests it also has roles in regulating the immune system and inflammation. The synthetic form is called aviptadil.

Also known as: Vasoactive intestinal peptide, Vasoactive intestinal polypeptide, Aviptadil

What are peptides?

What the research covers

VIP has been studied widely in cell and animal models of inflammation, immune disorders and nerve cell protection. Small human studies have examined inhaled VIP in pulmonary hypertension and intravenous or inhaled aviptadil in severe respiratory illness, with mixed results. Its use for healthy ageing has not been studied in clinical trials. Aviptadil combined with phentolamine has been approved in the UK and some European countries as an injection for erectile dysfunction. Aviptadil is not approved by the US FDA.

References

Petkov V, Mosgoeller W, Ziesche R, et al.. Vasoactive intestinal peptide as a new drug for treatment of primary pulmonary hypertension. Journal of Clinical Investigation. 2003.

Formats available

Pen

Pre-filled pen for subcutaneous use, prescription only.

Vial (injectable)

Vial for subcutaneous injection, prepared by the pharmacy, prescription only.

Storage and handling

Storage: Vials are usually supplied lyophilised (freeze-dried). Once reconstituted, keep the vial refrigerated at 2-8°C, protected from light, and do not freeze. Pens should be kept refrigerated at 2-8°C and protected from light. Follow the storage instructions on your pharmacy label.

Peptide Calculator

Specification

Property	Value
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Molecular formula	C147H237N43O43S
Molecular weight	approx. 3326 g/mol
Peptide length	28 amino acids
Formats	Pen, Vial (injectable)

Frequently asked questions

What does the research on VIP show?

VIP has been studied extensively in cells and animals for inflammation and immune regulation, and in small human studies for lung conditions. Results in people are mixed, and it has not been studied in trials for healthy ageing.

Is VIP an approved medicine?

Aviptadil, the synthetic form of VIP, combined with phentolamine is approved in the UK and some European countries for erectile dysfunction. It is not approved by the US FDA. Our product is a compounded preparation prescribed by our GP.

Which formats are available and how do I store them?

We supply VIP as a pen or vial. Keep pens and reconstituted vials refrigerated at 2-8°C, protected from light. Follow the storage instructions on your pharmacy label.

Are there side effects?

Side effects can occur. Your GP will review your health, medication and, where relevant, blood results before prescribing, and you should report anything unexpected.

VIP